Rekombinant Macaca melezi (Rhesus makak) Apelin reseptörü (APLNR) (Rekombinant Protein)

Rekombinant Macaca melezi (Rhesus makak) Apelin reseptörü (APLNR) (Rekombinant Protein)

Emre için Kİ
₺ 1.00
kullanılabilirlik:

Genel ad : APLNR; APJ; AGTRL1; AGTRL1, APJ.Syn Name : Rekombinant (Rhesus makak) Apelin reseptörü( APLNR); Apelin reseptörü.Anjiyotensin reseptörü benzeri 1 G proteine bağlı reseptör APJ; apelin reseptörü.anjiyotensin reseptörü benzeri 1; G-proteinine bağlı reseptör APJ; anjiyotensin II reseptörü benzeri 1. Anjiyotensin reseptörü benzeri 1. Kaynak : E. Coli veya Maya.Saflık : >%90 ;* Etiket Bilgisi : Etiketlendi; * Türler : Macaca melezi (Rhesus makak).Depolama Tamponu : PBS p H 7.4, %50 gliserol; * Seq Pos : 1-380. Depolama : -20 derece C'de saklayın. Genişletilmiş depolama için -20 veya -80 derece C'de saklayın.Bu öğe için ücretsiz-8 GB-USBDrive.Madde araştırma kullanımı içindir.Teşhis / tedavi prosedürü için değil. * Form : Bu ürün özel üretim gerektirir ve teslim süresi 5-9 hafta arasındadır.Spesifikasyonlarınıza göre özel üretim yapabiliriz.; * Sıra : MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFSCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVFRTTGDLENTTKVQCYMDYSMVATVSSDWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNVFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD; * Katılım# : NP_001040591.1; NM_001047126.1; O97666; *Uniprot Özeti : İşlev : Adenilat siklaz aktivitesini inhibe eden G proteinlerine bağlı apelin reseptörü.SIV enfeksiyonu için CD4 ile alternatif koreseptör.Hücre altı konum : Hücre zarı; Çok geçişli membran proteini.Dizi benzerlikleri : G-proteinine bağlı reseptör 1 ailesine aittir.

Ürün hakkında

Müşteri seçim